LL-37 5mg

Buy LL-37 5mg here at Biotech Peptides: an antimicrobial peptide in a 5mg vial, sealed and freeze-dried. You pay $86 and shipping costs nothing, whether the order goes across the US or overseas. Our label says it plainly: synthesized and lyophilized in the USA. The lot paperwork (COA, HPLC trace and mass spectrum) is in the product images.

What is LL-37?

LL-37 is the only cathelicidin antimicrobial peptide humans make. It’s 37 amino acids long and starts with two leucines, which is where the name comes from. It’s cut from a larger precursor protein, hCAP-18, and is found in white blood cells, skin and the lining of the airways and gut.

It’s amphipathic, with one charged face and one oily face, so it can sit in and disrupt bacterial membranes.

LL-37 in published research

Lab work shows it kills a wide range of bacteria and some fungi and viruses in culture, and it also acts as a signaling molecule in inflammation and wound repair. Heilborn and colleagues reported in 2003 that it’s needed for normal re-epithelialization of human skin wounds in culture.

Human data are limited to small early-phase studies, for example on venous leg ulcers.

For the primary literature, PubMed lists the LL-37 studies.

The biology behind LL-37

LL-37 has a positively charged face that’s drawn to the negatively charged membranes of bacteria. Once it’s there, its oily face pushes into the membrane and makes holes.

It does more than kill microbes. It binds bacterial endotoxin, recruits immune cells and stimulates new blood vessel growth, which ties it into wound healing studies.

LL-37 5mg at a glance: the specs

• Compound: LL-37
• Other names: cathelicidin, CAP-18 fragment
• CAS number: 154947-66-7
• Molecular formula: C205H340N60O53
• Molecular weight: 4,493.3 g/mol
• Sequence or structure: [LL-37, 37 aa]
• Amount: 5mg
• Form: lyophilized (freeze-dried) powder
• Made: synthesized and lyophilized in the USA
• Lot paperwork: COA, HPLC and MS images in the gallery
• SKU: LL-37-5mg

LL-37 5mg COA and lab reports

The COA in the gallery covers appearance, molecular weight by mass spec, HPLC purity, assay, solubility and residual TFA and acetic acid for the lot. The raw HPLC and MS plots are there too.

Need the documents as files? Ask through the contact page and include the product and lot number.

LL-37 5mg reconstitution and storage

Divide 5mg by the volume of water and you have the concentration:

• 1mL of water: 5mg per mL
• 2mL of water: 2.5mg per mL
• 3mL of water: 1.67mg per mL

Use sterile bacteriostatic water and add it slowly, aiming at the glass instead of the powder. A gentle swirl is all it needs.

Dry vials last longest frozen at -20°C. Reconstituted solution goes in the fridge and is best used within four weeks or so.

Planning a study with LL-37 5mg

Map out the doses per group, multiply by the number of days, and add a margin. It’s cheaper to order one extra vial at the start than to restart a study.

Where LL-37 fits

In short, LL-37 is the only human cathelicidin, an antimicrobial peptide that also signals in wound repair. Here’s how its neighbors differ:

• Thymosin Alpha-1 is a 28-amino-acid thymic peptide, approved in several countries as thymalfasin
• VIP is a 28-amino-acid neuropeptide that relaxes smooth muscle and calms immune cells
• Thymalin is a thymus peptide complex from the Leningrad bioregulator program
• PNC-27 is a p53-derived peptide that binds HDM-2 on cancer cell membranes

All are immune research tools, but they act at very different points, from T cell maturation to direct antimicrobial action. All of them are on our immune peptides page.

Often ordered with LL-37 5mg

• ARA-290 16mg, an EPO-derived peptide
• Thymalin 25mg, a thymic peptide complex
• Thymosin Alpha-1 10mg, a thymic peptide
• KPV 4mg, an alpha-MSH tripeptide

Keep browsing: immune peptides, or the whole Biotech Peptides catalog.

LL-37 5mg from a store that sells peptides only

Our catalog is narrow on purpose: research peptides, blends and cosmetic peptide powders. That keeps stock moving, so the vial you order isn’t one that has been sitting on a shelf for a year.

Problems with an order go through the contact page. Include the order number and a photo of anything damaged.

Free shipping on LL-37 5mg

Every order ships free, domestic or international. Dry peptide is stable at room temperature for the length of a normal delivery, so there’s no ice pack surcharge. Freeze it once it lands.

Every product is listed in our shop, and the Biotech Peptides Shop home page links to the blog’s country-by-country delivery guides.

Common questions about LL-37 5mg

What do I reconstitute LL-37 5mg with?

Sterile bacteriostatic water. The mixing section above lists concentrations for common volumes.

How should LL-37 5mg be stored?

Frozen at -20°C while dry. After mixing, in the fridge at 2 to 8°C, used within about four weeks.

Does LL-37 5mg come with a COA?

Yes. The certificate of analysis, HPLC trace and mass spectrum for the lot are in the product images.

Is LL-37 5mg in stock?

Yes. We have it in stock now.

Where can I buy LL-37 5mg?

Order it on this page. We sell direct, so there’s no reseller markup.

Order LL-37 5mg from Biotech Peptides

Ready to order? It is $86 and ships free. Use the cart button at the top of the page.

Building a larger order? Browse the immune peptides as well.

For laboratory research only. Not for human or veterinary use, and not evaluated by the FDA.